PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004412
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 240aa    MW: 26728 Da    PI: 9.1869
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004412genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.81.2e-35131131101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa++Cvlap fp +++++f nvhklFG++n+++++k+++ ++r da++s+v eA  ra dP  Ga++++++lq++++++kael+l++
  DCAR_004412  13 ACAACKHQRRKCAPECVLAPFFPPHRQAEFLNVHKLFGVRNIMNTVKKVEMSRRGDAVRSMVHEAYFRAVDPAGGAYRILSHLQHRYNHMKAELDLVR 110
                  7************************************************************************************************9 PP

       DUF260  99 eel 101
                  ++l
  DCAR_004412 111 QQL 113
                  986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.88512113IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-3413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MTGPAGGSSV SQACAACKHQ RRKCAPECVL APFFPPHRQA EFLNVHKLFG VRNIMNTVKK  60
VEMSRRGDAV RSMVHEAYFR AVDPAGGAYR ILSHLQHRYN HMKAELDLVR QQLAIFRSVQ  120
IDGIGSEHMQ HPPLNYSNFG RKESAEAINQ TDDITSPRIN ILRGDIIKKE GSSSNRDKKT  180
MRLEKKGSAS NLDNGTFESA PYDGNGNTKI DNIDENHSSS RSHENETNSL EDVKLNVRD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068972.13e-39PREDICTED: LOB domain-containing protein 22-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1783424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.11e-33LOB domain-containing protein 7